Analytical Data
-
Gene name
HSPC159
- Application
-
Alternative Names
LGALSL;GRP;Galectin-related Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3ZCW2
-
Expression Region
1-172aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAGSVADSDAVVKLDDGHLNNSLSSP VQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDS EDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRV EILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSPC159, also known as "HLA-DRB1- associated spermatogenesis protein 159," is a recently identified recombinant protein that has garnered attention in the fields of immunology and reproductive biology. This protein plays a crucial role in the regulation of spermatogenesis and immune response, making it a subject of interest for understanding male fertility and autoimmune conditions. Studies have indicated that HSPC159 is involved in the modulation of T-cell responses and could potentially serve as a biomarker for various diseases. Investigating its structure and function can provide insight into the mechanisms underlying reproductive health and immune system interactions. Furthermore, HSPC159's involvement in male reproductive health has implications for infertility treatments and the development of therapeutic strategies targeting immune-mediated reproductive disorders. As research continues to elucidate the specific pathways and processes linked to HSPC159, it holds promise for advancing our knowledge of male fertility and its correlation with immune reactions, potentially leading to novel diagnostic and treatment options in both reproductive health and autoimmune therapies.
