Analytical Data
-
Gene name
TPSb2
- Application
-
Alternative Names
TPSb2;TPS2;Tryptase beta-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20231
-
Expression Region
31-275aa
-
AA Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
-
Molecular Weight
31.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPSb2 recombinant protein is a key focus in research due to its potential applications in various fields, including biomedicine and industrial biotechnology. Initially identified as a part of the trehalose-6-phosphate synthase (TPS) enzyme family, TPSb2 plays a crucial role in carbohydrate metabolism, specifically in the biosynthesis of trehalose, a disaccharide known for its protective properties under stress conditions such as dehydration, heat, and oxidative stress. The relevance of trehalose in cellular protection has sparked interest in understanding TPSb2's structure and function more deeply, as it could lead to innovative strategies for enhancing stress tolerance in crops, improving the shelf life of food products, and developing new therapeutic avenues for diseases linked to metabolic dysregulation. Additionally, the recombinant expression of TPSb2 allows researchers to study its enzymatic properties and interactions in detail, paving the way for applications in synthetic biology and metabolic engineering. With advances in genomics and proteomics, the manipulation of TPSb2 provides exciting possibilities for enhancing the efficiency of biotechnological processes and improving health outcomes, making it a significant subject of ongoing research in the life sciences.











