Analytical Data
-
Gene name
HSPB8/HSP22
- Application
-
Alternative Names
HSPB8;CRYAC;E2IG1;HSP22;Heat shock Protein beta-8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UJY1
-
Expression Region
1-196aa
-
AA Sequence
MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPD WALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCV NVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVD PVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSPB8, also known as heat shock protein 22, is a member of the small heat shock protein (sHSP) family, which plays crucial roles in cellular stress response, protein homeostasis, and cytoprotection. Research has indicated that HSPB8 exhibits significant neuroprotective properties and is involved in various cellular processes such as protein folding, aggregation prevention, and apoptosis regulation. Dysregulation of HSPB8 has been implicated in several neurodegenerative diseases, including amyotrophic lateral sclerosis (ALS) and Alzheimer’s disease, making it a focal point for therapeutic research. Recombinant HSPB8 has been produced to study its biochemical properties, molecular interactions, and protective mechanisms in a controlled environment. By utilizing recombinant techniques, researchers can investigate the structure-function relationship of HSPB8 and its potential as a target for drug discovery. Moreover, the development of recombinant HSPB8 opens avenues for exploring its role in modulating stress responses and enhancing cellular resilience against various pathological conditions. This has significant implications for understanding disease mechanisms and developing novel treatment strategies for neurodegenerative disorders.
