Analytical Data
-
Gene name
IL20
- Application
-
Alternative Names
IL20；ZCYTO10；Interleukin-20
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYY1
-
Expression Region
25-176aa
-
AA Sequence
LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDT KPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLR LCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEE TE
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-20 (IL-20) is a cytokine belonging to the IL-10 family, primarily involved in inflammatory and immune responses. It is produced mainly by activated keratinocytes and plays a crucial role in skin-related conditions, such as psoriasis and atopic dermatitis, by promoting the proliferation of keratinocytes and altering the local immune response. Given its significant role in skin pathology and chronic inflammatory diseases, IL-20 has garnered considerable interest as a potential therapeutic target. Research has revealed that IL-20 receptor signaling can exacerbate inflammatory processes, thus making it an attractive candidate for investigation to understand its molecular mechanisms and the development of targeted therapies. Furthermore, the generation of recombinant IL-20 protein has facilitated various studies, including those exploring its structure-function relationships and interactions with its receptors. These studies not only deepen our understanding of IL-20’s role in immune modulation but also offer insights into potential interventions for treating IL-20-related diseases. Consequently, the development of IL-20 antagonists or modulators could hold promise for clinical applications, paving the way for novel strategies in the management of chronic inflammatory skin disorders.
