Analytical Data
-
Gene name
HSPB7
- Application
-
Alternative Names
HSPB7;CVHSP;Heat shock Protein beta-7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBY9
-
Expression Region
1-170aa
-
AA Sequence
MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSD DFGSFMRPHSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIR ARRHPHTEHVQQTFRTEIKILEHHHHHH
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSPB7, a member of the small heat shock protein (sHSP) family, has garnered significant research interest due to its potential protective roles in cellular stress responses, particularly in the context of cardiovascular diseases. Emerging evidence suggests that HSPB7 plays a crucial role in maintaining proteostasis, protecting cells from apoptosis, and modulating inflammation. Its expression is upregulated in response to various stressors, including oxidative stress and ischemia, highlighting its importance in cellular defense mechanisms. Dysregulation of HSPB7 has been linked to various pathological conditions, including heart failure and cardiomyopathies, making it a compelling target for therapeutic intervention. Recent studies have focused on the recombinant production of HSPB7 to better understand its functional properties and interactions with other cellular proteins. This approach not only facilitates the elucidation of its molecular mechanisms but also opens avenues for developing HSPB7-based therapies aimed at enhancing cardioprotection. As a result, investigating HSPB7 through recombinant protein techniques is pivotal for advancing our understanding of cardiovascular health and disease, paving the way for innovative treatment strategies.
