Cat: PA1000-1531

Recombinant Human HSPB7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HSPB7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HSPB7;CVHSP;Heat shock Protein beta-7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBY9

  • Expression Region

    1-170aa

  • AA Sequence

    MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSD DFGSFMRPHSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIR ARRHPHTEHVQQTFRTEIKILEHHHHHH

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HSPB7, a member of the small heat shock protein (sHSP) family, has garnered significant research interest due to its potential protective roles in cellular stress responses, particularly in the context of cardiovascular diseases. Emerging evidence suggests that HSPB7 plays a crucial role in maintaining proteostasis, protecting cells from apoptosis, and modulating inflammation. Its expression is upregulated in response to various stressors, including oxidative stress and ischemia, highlighting its importance in cellular defense mechanisms. Dysregulation of HSPB7 has been linked to various pathological conditions, including heart failure and cardiomyopathies, making it a compelling target for therapeutic intervention. Recent studies have focused on the recombinant production of HSPB7 to better understand its functional properties and interactions with other cellular proteins. This approach not only facilitates the elucidation of its molecular mechanisms but also opens avenues for developing HSPB7-based therapies aimed at enhancing cardioprotection. As a result, investigating HSPB7 through recombinant protein techniques is pivotal for advancing our understanding of cardiovascular health and disease, paving the way for innovative treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US