Cat: PA1000-1510

Recombinant Human HSF2BP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HSF2BP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HSF2BP;MEILB2;Heat shock factor 2-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75031

  • Expression Region

    1-334aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMGEAGAAEEACRHMGTKEEFVKVRKKD LERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMD CEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAA CTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDS DESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCT KLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLR LVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDL RTLEHNV

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HSF2BP (Heat Shock Factor 2-Binding Protein) is a versatile protein that plays a crucial role in the cellular stress response, particularly in the regulation of heat shock proteins (HSPs). Its relationship with Heat Shock Factor 2 (HSF2), a key transcription factor, highlights its importance in maintaining proteostasis under stress conditions such as elevated temperatures, oxidative stress, and other cellular challenges. Research has shown that HSF2BP modulates HSF2 activity and influences the expression of HSPs, which are essential for refolding misfolded proteins and preventing aggregation. Dysregulation of this pathway has been linked to various diseases, including neurodegenerative disorders and cancer. Thus, understanding the structure and function of HSF2BP as a recombinant protein can provide critical insights into its mechanisms of action. Studies involving recombinantly expressed HSF2BP allow researchers to explore its interaction with HSFs and downstream targets, elucidating the broader implications of stress responses in health and disease. Investigating HSF2BP's role in the heat shock response not only enhances our comprehension of cellular adaptation but also presents potential therapeutic avenues for conditions associated with proteostasis imbalances.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US