Analytical Data
-
Gene name
IMPG2
- Application
-
Alternative Names
IMPG2; IPM200; Interphotoreceptor matrix proteoglycan 2; Interphotoreceptor matrix proteoglycan of 200 kDa; IPM 200; Sialoprotein associated with cones and rods proteoglycan; Spacrcan
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZV3
-
Expression Region
572-678aa
-
AA Sequence
LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE
-
Molecular Weight
37.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IMPG2 (Interphotoreceptor Matrix Proteoglycan 2) is a member of the IMPG family, known for its critical role in the structure and function of the interphotoreceptor matrix (IPM) in the retina. This matrix is essential for maintaining photoreceptor cell health and function, influencing processes like retinal development and signaling. Dysregulation or mutations in the IMPG2 gene have been associated with various retinal disorders, including inherited forms of blindness, highlighting its importance in vision. Research into IMPG2 recombinant proteins has emerged as a promising avenue for understanding the molecular mechanisms underlying retinal diseases and exploring potential therapeutic strategies. By producing and characterizing these proteins, scientists aim to unravel the functional implications of IMPG2 in the IPM and its interactions with other retinal components. Furthermore, recombinant IMPG2 proteins can serve as valuable tools for developing gene therapy techniques, designing biomaterials for retinal repair, and elucidating the pathways involved in photoreceptor cell maintenance and survival. Overall, the study of IMPG2 recombinant proteins holds significant potential for advancing our knowledge of retinal biology and developing innovative treatments for vision impairment.
