Analytical Data
-
Gene name
IMP5
- Application
-
Alternative Names
SPPL2C; IMP5; Signal peptide peptidase-like 2C; SPP-like 2C; SPPL2c; EC 3.4.23.-; Intramembrane protease 5; IMP-5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IUH8
-
Expression Region
29-122aa
-
AA Sequence
VVSENWSKDYCILFSSDYITLPRDLHHAPLLPLYDGTKAPWCPGEDSPHQAQLRSPSQRPLRQTTAMVMRGNCSFHTKGWLAQGQGAHGLLIVS
-
Molecular Weight
36.08 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IMP5, or the imprinted gene protein 5, is a member of the imprinted gene family, which plays a crucial role in various biological processes, particularly in the context of genomic imprinting and development. Research into IMP5 has gained momentum due to its potential implications in reproductive biology, growth regulation, and disease associations, including cancer. Genomic imprinting is a complex phenomenon that leads to the expression of genes in a parent-of-origin-specific manner, influencing embryonic development and tissue differentiation. Recent studies suggest that IMP5 may be involved in regulating critical pathways in development and cellular differentiation, positioning it as a candidate for further investigation into its functional roles. Researchers are particularly interested in its expression patterns and potential regulatory mechanisms, as alterations in imprinted gene expression have been linked to various pathologies. The characterization of recombinant IMP5 protein is essential for dissecting its biological functions and interactions at the molecular level. By producing and studying this protein, scientists aim to illuminate its mechanisms of action, potential interactions with other proteins, and its overall contribution to cellular processes and developmental biology. Overall, the study of IMP5 and its recombinant form holds promise for advancing our understanding of gene regulation, developmental biology, and associated diseases, paving the way for novel therapeutic approaches in genetic disorders and cancer.
