Analytical Data
-
Gene name
HSD17B10
- Application
-
Alternative Names
TRMT10C;MRPP1;RG9MTD1;tRNA methyltransferase 10 homolog C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99714
-
Expression Region
2-261aa
-
AA Sequence
AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
-
Molecular Weight
42.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSD17B10, or hydroxysteroid 17-beta dehydrogenase 10, is a mitochondrial enzyme involved in the metabolism of steroids and plays a crucial role in the regulation of various biological processes, including steroid hormone biosynthesis and the catabolism of neuroactive steroids. Recent studies have highlighted its significant involvement in neurodegenerative diseases, particularly Alzheimer’s disease, where it has been linked to alterations in steroid metabolism and neuroinflammation. The enzyme exists in multiple forms, and its expression is tissue-specific, indicating its potential role in diverse physiological and pathological conditions. Given its importance, the recombinant expression of HSD17B10 is critical for further research, allowing scientists to explore its enzymatic properties, regulatory mechanisms, and biochemical pathways. The production of the recombinant protein facilitates detailed structural analyses and functional assays that are essential for understanding its role in health and disease. Moreover, studying HSD17B10 can offer insights into developing therapeutic strategies for conditions associated with steroid imbalance and neurodegenerative disorders. As such, the research on recombinant HSD17B10 not only enhances our comprehension of this enzyme's biological functions but also opens avenues for potential clinical applications in treating related ailments.
