Analytical Data
-
Gene name
IMMP1L
- Application
-
Alternative Names
IMMP1LMitochondrial inner membrane protease subunit 1; EC 3.4.21.-; IMP1-like protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96LU5
-
Expression Region
1-166aa
-
AA Sequence
MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD
-
Molecular Weight
44.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IMMP1L (Inner Mitochondrial Membrane Protease 1 Like) is a mitochondrial enzyme that plays a crucial role in protein quality control within the mitochondria, an organelle essential for energy production and cellular metabolism. Recent studies have established that IMMP1L is involved in the processing and degradation of mitochondrial precursor proteins, which is vital for maintaining mitochondrial function and integrity. Given its significance, dysregulation of IMMP1L has been implicated in various mitochondrial disorders and has potential links to age-related diseases. Research focusing on the recombinant expression of IMMP1L protein aims to elucidate its functional mechanisms, elucidate its interactions with mitochondrial substrates, and explore its potential as a therapeutic target. Recombinant IMMP1L has allowed for in-depth biochemical and structural studies, which are essential for understanding its role in mitochondrial biogenesis and pathology. The insights gained from these studies could pave the way for novel therapeutic strategies for diseases stemming from mitochondrial dysfunction, making IMMP1L a protein of increasing interest in the field of mitochondrial biology and medicine.
