Analytical Data
-
Gene name
HSBP1L1
- Application
-
Alternative Names
HSBP1L1;Heat shock factor-binding Protein 1-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
C9JCN9
-
Expression Region
1-74aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMDVRGPEAPGGRALRDAAENLFQEQEH FQALTATLNLRMEEMGNRIEDLQKNVNDLMVQAGIENSIKEQMLKT
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSBP1L1 (Heat Shock Factor Binding Protein 1-Like 1) is a member of the HSP family, playing a crucial role in cellular stress responses and gene regulation. Research into HSBP1L1 has gained significance due to its involvement in various physiological processes, including cell growth, apoptosis, and differentiation. Recent studies have suggested that HSBP1L1 may have important implications in cancer biology, particularly in how cancer cells respond to stress and therapeutic interventions. The recombinant protein of HSBP1L1 has been a focal point as it allows for detailed analysis of its structure-function relationships, potential interactions with other proteins, and its regulatory mechanisms under stress conditions. By producing HSBP1L1 as a recombinant protein, researchers can investigate its biochemical properties, aiding in the elucidation of its role in oncogenesis and other diseases. This has further implications for developing targeted therapies that could modulate its activity in pathological states. Overall, the study of HSBP1L1 and its recombinant form remains an exciting area of investigation with the potential to provide insights into cellular stress responses and innovative therapeutic strategies.
