Cat: PA2000-234DB

Recombinant Human HSD11b1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HSD11b1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HSD11b1;HSD11;HSD11L;SDR26C1;11-beta-hydroxysteroid dehydrogenase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28845

  • Expression Region

    1-292aa

  • AA Sequence

    MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREM AYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAE QFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVL TVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGA LRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The enzyme 11β-hydroxysteroid dehydrogenase type 1 (HSD11B1) plays a pivotal role in the metabolism of glucocorticoids, converting inactive cortisone to its active form, cortisol. This enzymatic activity is crucial in various physiological processes, including the regulation of metabolism, immune response, and stress responses. Dysregulation of HSD11B1 has been associated with several metabolic disorders, such as obesity, type 2 diabetes, and hypertension. Consequently, understanding the functional properties of HSD11B1 is essential for exploring its potential as a therapeutic target. Researchers have developed recombinant forms of the HSD11B1 protein to investigate its structure, enzymatic activity, and interaction with various substrates and inhibitors. These studies provide valuable insights into the molecular mechanisms underlying glucocorticoid action and contribute to the development of novel interventions aimed at modulating HSD11B1 activity in metabolic diseases. By creating and characterizing this recombinant protein, scientists aim to pave the way for innovative treatments that could alleviate the health burden associated with glucocorticoid-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US