Analytical Data
-
Gene name
TERT
- Application
-
Alternative Names
TERT；EST2；TCS1；TRT；Telomerase reverse transcriptase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14746
-
Expression Region
281-436aa
-
AA Sequence
EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA
-
Molecular Weight
22.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Telomerase reverse transcriptase (TERT) is a critical enzyme that plays a key role in the maintenance of telomeres, the protective structures at the ends of chromosomes. Telomeres shorten with each cell division, leading to cellular aging and ultimately to senescence or apoptosis. The reactivation of TERT is often observed in cancer cells, enabling them to proliferate indefinitely by maintaining telomere length. Research into TERT has gained significant attention due to its dual role in both aging and cancer. Understanding the mechanisms that regulate TERT expression and activity can provide insights into potential therapeutic targets for age-related diseases and cancer treatment. Studies have shown that various factors, including genetic mutations, epigenetic modifications, and signaling pathways, can influence TERT expression. Developing recombinant TERT proteins has opened new avenues for investigating its functional roles in telomere biology and elucidating its involvement in tumorigenesis. By exploring TERT's molecular interactions and biochemical properties, researchers aim to design targeted interventions that can modulate its activity in a clinical context. Additionally, TERT is being studied as a biomarker for cancer diagnosis and prognosis, further underscoring its significance in both basic and applied biological research.
