Analytical Data
-
Gene name
UGT72B1
- Application
-
Alternative Names
UGT72B1；UDP-glycosyltransferase 72B1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9M156
-
Expression Region
1-480aa
-
AA Sequence
MEESKTPHVAIIPSPGMGHLIPLVEFAKRLVHLHGLTVTFVIAGEGPPSKAQRTVLDSLPSSISSVFLPPVDLTDLSSSTRIESRISLTVTRSNPELRKVFDSFVEGGRLPTALVVDLFGTDAFDVAVEFHVPPYIFYPTTANVLSFFLHLPKLDETVSCEFRELTEPLMLPGCVPVAGKDFLDPAQDRKDDAYKWLLHNTKRYKEAEGILVNTFFELEPNAIKALQEPGLDKPPVYPVGPLVNIGKQEAKQTEESECLKWLDNQPLGSVLYVSFGSGGTLTCEQLNELALGLADSEQRFLWVIRSPSGIANSSYFDSHSQTDPLTFLPPGFLERTKKRGFVIPFWAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKAHKKELEQNGNH
-
Molecular Weight
60.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UGT72B1 is a member of the UDP-glucuronosyltransferase (UGT) enzyme family, which plays a crucial role in the metabolism and detoxification of various endogenous and exogenous compounds through the process of glucuronidation. This enzyme is notably involved in the biotransformation of phenolic compounds, flavonoids, and other phytochemicals, which are abundant in plants and have significant health benefits. The study of UGT72B1 is particularly important in the context of plant secondary metabolism, as it contributes to the modification and excretion of potentially harmful substances, thus enhancing plant resistance to environmental stressors. Furthermore, understanding the functional properties and substrate specificity of UGT72B1 can provide insights into the metabolic pathways of important agricultural crops and medicinal plants, potentially leading to the development of strategies for improving crop quality and resistance. Given the increasing interest in biopharmaceuticals and natural products, the recombinant expression of UGT72B1 in suitable expression systems allows for detailed biochemical characterization and functional studies, helping to elucidate its role in plant metabolism and its potential applications in biotechnology and agriculture. Through such research, we can better harness the capabilities of this enzyme for metabolic engineering and the sustainable production of valuable compounds.
