Analytical Data
-
Gene name
IGSF10
- Application
-
Alternative Names
6530405F15Rik; 9030224D03; AA409708; AA536958; Adlican2; AI414626; Calvaria mechanical force protein 608; CMF608; IGS10_HUMAN; IgSF10; Immunoglobulin superfamily member 10
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6WRI0
-
Expression Region
301-399aa
-
AA Sequence
SAFISPQGFMAPFGSLTLNMTDQSGNEANMVCSIQKPSRTSPIAFTEENDYIVLNTSFSTFLVCNIDYGHIQPVWQILALYSDSPLILERSHLLSETPQ
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IGSF10 (Immunoglobulin Superfamily Member 10) is a transmembrane protein that plays a significant role in neuronal development and function. Disruptions in the IGSF10 gene have been associated with various neurodevelopmental disorders, particularly those affecting reproductive health and neurocognitive functions. Recent studies have highlighted its involvement in the migration and differentiation of neurons, suggesting its potential role in synaptic plasticity and neural network formation. Researchers are increasingly interested in characterizing the structural and functional properties of the IGSF10 protein through recombinant expression systems, which allow for the production of large quantities of the protein for further investigation. Understanding the mechanisms by which IGSF10 influences neuronal processes could provide insights into the underlying causes of the associated disorders, thus opening avenues for therapeutic interventions. The recombinant IGSF10 protein can also serve as a valuable tool for studying its interactions with other cellular components, paving the way for more comprehensive studies on its role in the central nervous system.
