Analytical Data
-
Gene name
LAMa5
- Application
-
Alternative Names
LAMa5；KIAA0533；KIAA1907；Laminin subunit alpha-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15230
-
Expression Region
3401-3692aa
-
AA Sequence
FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC
-
Molecular Weight
47.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMa5, or Laminin alpha-5, is a vital protein that plays a significant role in the structure and function of the extracellular matrix (ECM), particularly in tissues such as the basal lamina. It is a component of laminin, a crucial glycoprotein that influences cellular behavior, including adhesion, migration, and differentiation. Research into LAMa5 has gained momentum due to its implications in various physiological and pathological processes, including wound healing, tissue regeneration, and cancer metastasis. Studies have shown that LAMa5 is involved in the regulation of cell signaling pathways and the maintenance of tissue architecture. The recombinant expression of LAMa5 can provide a deeper understanding of its structural properties, interactions with other ECM components, and its potential therapeutic applications. Moreover, investigating LAMa5's role in diseases, such as muscular dystrophies and certain cancers, highlights its importance as a biomarker and a target for novel treatment strategies. Developing recombinant LAMa5 can facilitate high-throughput screening of drugs and enable the design of biomimetic scaffolds for tissue engineering, thus advancing both basic research and clinical applications in regenerative medicine. As a result, the study of LAMa5 and its recombinant forms is a rapidly evolving field with significant potential for improving our understanding of numerous biological processes and developing innovative therapeutic interventions.
