Analytical Data
-
Gene name
LAMa4
- Application
-
Alternative Names
LAMa4；Laminin subunit alpha-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16363
-
Expression Region
1-120aa
-
AA Sequence
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPET SEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQC LESFTWARSVRKLEIKSFPL
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research surrounding LAMa4, a recombinant protein, has gained significant attention due to its potential applications in various fields, including biotechnology and medicine. LAMa4 is derived from the laminin protein family, which plays a crucial role in cell adhesion, differentiation, and tissue organization. Understanding and harnessing the properties of LAMa4 can lead to advancements in regenerative medicine and tissue engineering, as it may facilitate cell-matrix interactions essential for tissue repair and growth. Recent studies have focused on its molecular structure and biological functions, revealing insights into how it interacts with different cell types and influences cellular behavior. Moreover, as a recombinant protein, LAMa4 can be produced in controlled environments, allowing for scalable production and purification techniques that enhance its applicability in therapeutic contexts. Given its potential to improve wound healing and tissue regeneration, ongoing research is exploring its use in developing novel biomaterials and therapeutic agents, aiming to address a range of medical conditions from chronic wounds to degenerative diseases. Thus, LAMa4 represents a promising avenue in the intersection of molecular biology and clinical applications, with the potential to impact future therapeutic strategies significantly.
