Analytical Data
-
Gene name
IGLV6-57
- Application
-
Alternative Names
IGLV6-57; Immunoglobulin lambda variable 6-57; Ig lambda chain V-VI region AR; Ig lambda chain V-VI region EB4; Ig lambda chain V-VI region NIG-48; Ig lambda chain V-VI region SUT; Ig lambda chain V-VI region WLT
-
Species
Human
-
Source
E. coli
-
Tag
His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01721
-
Expression Region
1-117aa
-
AA Sequence
MAWAPLLLTLLAHCTGSWANFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSN
-
Molecular Weight
12,5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The IGLV6-57 protein, a member of the immunoglobulin lambda light chain gene family, has garnered significant interest in immunology and biotechnology due to its role in the immune response and potential applications in therapeutic antibody development. Immunoglobulin light chains are crucial components of antibodies, providing specificity to antigen binding and contributing to the overall stability and functionality of immunoglobulins. The IGLV6-57 gene, specifically, is notable for its diverse variable region that can generate a range of antibodies with unique antigen-binding properties. Research into IGLV6-57 has focused on its recombinant expression, structural characterization, and potential uses in designing monoclonal antibodies for diagnostic and therapeutic purposes, particularly in targeting infectious diseases, cancer, and autoimmune disorders. Additionally, studies have explored the evolution and selection of IGLV6-57 variants in response to pathogen exposure, shedding light on the adaptive immune response's complexity. Understanding this protein's mechanisms and functionalities could pave the way for innovative treatments and enhance our understanding of immune system dynamics. Overall, the investigation of IGLV6-57 recombinant protein is a promising area of research with implications for both basic science and clinical applications.
