Analytical Data
-
Gene name
DIP2A
- Application
-
Alternative Names
DIP2A;C21orf106;DIP2;KIAA0184;Disco-interacting Protein 2 homolog A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14689
-
Expression Region
9-127aa
-
AA Sequence
EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSS
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DIP2A, a member of the DIP (Domain of Unknown Function, DUF) family, is a protein that has garnered interest due to its potential roles in various biological processes, including neuronal function and intracellular signaling. Research indicates that DIP2A may be involved in synaptic plasticity and the regulation of neurotransmitter release, making it a candidate for studying neurodevelopmental and neurodegenerative disorders. Preliminary studies have suggested that mutations or dysregulation of DIP2A could contribute to conditions such as autism spectrum disorders and schizophrenia. Additionally, its expression patterns in the brain highlight its importance in neurobiological contexts. Given the intricate relationships between protein dysfunction and disease pathology, recombinant forms of DIP2A are being produced to elucidate its structure-function relationships and biochemical mechanisms. These recombinant proteins are vital for in vitro studies, allowing researchers to dissect the molecular interactions and pathways involving DIP2A. Advances in protein engineering and expression systems have facilitated the generation of high-quality DIP2A proteins, which can be used in various assays to study their functionality and the impact of specific mutations. Understanding DIP2A's role at the molecular level could provide insights into its contributions to neural function and its potential as a therapeutic target, hence driving further research into its biological significance and applications in medicine.











