Analytical Data
-
Gene name
IFRG15
- Application
-
Alternative Names
TOR1AIP2; IFRG15; LULL1; Torsin-1A-interacting protein 2; Lumenal domain-like LAP1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NFQ8
-
Expression Region
1-131aa
-
AA Sequence
MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK
-
Molecular Weight
41.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFRG15, also known as Interferon Regulated Gene 15, is a member of the ISG15 family, which plays a crucial role in the immune response, particularly in the context of viral infections and inflammation. This protein functions as a ubiquitin-like modifier, facilitating the post-translational modification of target proteins through a process known as ISGylation. This modification can influence various cellular processes, including protein stability, localization, and activity, thereby affecting the overall immune response. Research on IFRG15 has gained significant attention due to its potential implications in various diseases, including cancer and autoimmune disorders. Studies have demonstrated that IFRG15 expression can be induced by type I interferons, linking it to antiviral defense mechanisms. Additionally, aberrant regulation of IFRG15 has been associated with pathological conditions, making it a promising target for therapeutic interventions. Understanding the structure and function of IFRG15 through recombinant protein studies can provide insights into its role in immune modulation, paving the way for novel strategies in disease management and treatment.
