Analytical Data
-
Gene name
mcjB
- Application
-
Alternative Names
mcjB；Microcin J25-processing Protein McjB
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9X2V8
-
Expression Region
1-208aa
-
AA Sequence
MIRYCLTSYREDLVILDIINDSFSIVPDAGSLLKERDKLLKEFPQLSYFFDSEYHIGSVSRNSDTSFLEERWFLPEPDKTLYKCSLFKRFILLLKVFYYSWNIEKKGMAWIFISNKKENRLYSLNEEHLIRKEISNLSIIFHLNIFKSDCLTYSYALKRILNSRNIDAHLVIGVRTQPFYSHSWVEVGGQVINDAPNMRDKLSVIAEI
-
Molecular Weight
32.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The mcjB gene, also known as the "methylated cytosine-binding protein J" gene, has garnered significant attention in the field of molecular biology and biotechnology due to its potential roles in epigenetic regulation and gene expression. It encodes a protein that is involved in recognizing and binding methylated DNA, which is a crucial mechanism for regulating gene activity in various biological processes, including development, differentiation, and responses to environmental stimuli. In recent years, researchers have focused on the production and characterization of recombinant mcjB protein to better understand its structural and functional properties. The ability to produce mcjB as a recombinant protein enables detailed studies of its binding affinity to methylated cytosines, providing insight into its role in epigenetic regulation. Additionally, recombinant mcjB protein can serve as a valuable tool in developing new therapeutic approaches for diseases associated with dysregulation of DNA methylation, such as cancer. Investigations into mcjB also offer broader implications for genetic engineering, synthetic biology, and the creation of biosensors that can detect specific methylation patterns in DNA. Therefore, the study of mcjB recombinant protein is not only pivotal for understanding fundamental biological mechanisms but also holds promise for innovative applications in medicine and biotechnology.
