Cat: PA2000-4265

Recombinant E.coli hlyE Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    hlyE

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    hlyE;clyA;hpr;sheA;Hemolysin E. chromosomal

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P77335

  • Expression Region

    2-182aa

  • AA Sequence

    TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAA

  • Molecular Weight

    21.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The hlyE gene, coding for the Hemolysin E protein, has garnered significant attention in microbial pathogenesis and protein engineering research. Originally identified in various pathogenic strains of bacteria, particularly in the context of enterohemorrhagic Escherichia coli (EHEC), hlyE plays a pivotal role in bacterial virulence by contributing to cell lysis and facilitating tissue invasion. Its ability to induce cytolytic effects makes it a focal point for studies aimed at understanding bacterial-host interactions. Researchers are investigating the mechanisms by which hlyE disrupts cellular membranes, aiming to elucidate its structure-function relationships. Additionally, as a candidate for vaccine development and therapeutic applications, recombinant hlyE protein is being explored for its potential to enhance immune responses. The production of recombinant hlyE in various expression systems allows for detailed structural and functional characterizations, paving the way for novel antimicrobial strategies. Furthermore, understanding this protein's role in pathogenesis could lead to innovations in diagnosing and treating infections caused by hemolytic bacteria. Thus, hlyE serves as a crucial model for studying microbial virulence factors and advancing biotechnological applications in medicine and vaccine development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US