Cat: PA2000-174DB

Recombinant Human IL18R Beta Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL18R Beta

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL18R Beta;

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95256

  • Expression Region

    20-356aa

  • AA Sequence

    FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPE HLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVN NSGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGS TGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTY VCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPL TISCKARFGFERVFNPVIKWYIKDSDLEWEVSVPEAKSIKSTLKDEIIER NIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRVDHHHHHH

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-18 receptor beta (IL18Rβ) is a crucial component of the interleukin-18 (IL-18) signaling pathway, which plays a significant role in the immune response and inflammation. IL-18, an important pro-inflammatory cytokine, is primarily produced by activated macrophages and is known to enhance the production of interferon-gamma (IFN-γ) from T cells and natural killer (NK) cells, thereby supporting the body's defense against intracellular pathogens. Research on IL18Rβ focuses on its role in various diseases, including autoimmune disorders, infectious diseases, and cancers. The study of recombinant IL18Rβ proteins has opened avenues for understanding its function and its potential as a therapeutic target. By generating recombinant IL18Rβ, researchers can investigate its interactions with IL-18 and downstream signaling mechanisms. Furthermore, recombinant proteins serve as essential tools for developing diagnostic assays and immunotherapies. Given the rising interest in the modulation of cytokine signaling pathways for therapeutic purposes, IL18Rβ holds promise for novel treatment strategies, particularly in diseases characterized by dysregulated inflammation. Overall, the exploration of IL18Rβ is vital for elucidating its biological roles and harnessing its potential in clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US