Analytical Data
-
Gene name
HDHD2
- Application
-
Alternative Names
HDHD2;Haloacid dehalogenase-like hydrolase domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0R4
-
Expression Region
1-259aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQE ALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAAR SLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQA FRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKP EKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRA SDEEKINPPPYLTCESFPHAVDHILQHLL
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HDHD2 (Haloacid Dehalogenase-Related Hydrolase Domain Protein 2) is a member of the haloacid dehalogenase superfamily, which plays a critical role in various biological processes, including signal transduction and metabolic pathways. The study of HDHD2 is significant due to its potential involvement in human diseases, such as cancer and metabolic disorders, where the modulation of its enzymatic activity may provide therapeutic avenues. Researchers have focused on elucidating the protein's structure and function to understand its catalytic mechanisms and substrate specificity. Advanced techniques, including X-ray crystallography and cryo-electron microscopy, have contributed to modeling the protein's three-dimensional structure, revealing crucial active site residues that govern its hydrolase activity. Furthermore, the exploration of HDHD2's interactions with various biomolecules has garnered attention, aiming to decipher its role in cellular signaling and regulation. Insights gained from HDHD2 research not only enhance our understanding of its biological significance but also pave the way for potential applications in drug discovery and the development of novel therapeutic strategies targeting associated diseases. As a result, comprehensive studies on HDHD2 are gaining momentum within the scientific community, highlighting its importance in both fundamental research and applied biomedical sciences.











