Analytical Data
-
Gene name
HDHD1A
- Application
-
Alternative Names
PUDP;DXF68S1E;FAM16AX;GS1;Pseudouridine-5'-phosphatase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q08623
-
Expression Region
1-228aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAAPPQPVTHLIFDMDGLLLDTERLYSVVF QEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQT KLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEF FSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNG VEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HDHD1A is a member of the haloacid dehalogenase (HAD) family of enzymes, which play essential roles in various biological processes, including metabolism and signal transduction. The HDHD1A gene encodes a protein that is characterized by its ability to hydrolyze phosphate esters, making it crucial for cellular signaling and homeostasis. Research into HDHD1A has grown in importance due to its potential involvement in various health conditions, such as neurodegenerative diseases and cancer. Recent studies have demonstrated that aberrant expression or mutations in HDHD1A can disrupt normal cellular functions, suggesting its role as a biomarker or therapeutic target. Additionally, understanding the structure and function of HDHD1A may shed light on the mechanisms of enzyme regulation and activity, which could lead to the development of novel biotechnological applications and therapies. As such, the investigation of HDHD1A recombinant protein is vital for elucidating its functional roles in biological systems and its implications in disease pathogenesis. Researchers are keen to explore the enzyme's kinetics, substrate specificity, and interaction with other cellular components to unlock its potential in both fundamental biology and applied biomedical research.
