Analytical Data
-
Gene name
HTR1E
- Application
-
Alternative Names
HTR1E; 5-hydroxytryptamine receptor 1E; 5-HT-1E; 5-HT1E; S31; Serotonin receptor 1E
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28566
-
Expression Region
206-276aa
-
AA Sequence
YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG
-
Molecular Weight
33.55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HTR1E is a member of the 5-hydroxytryptamine (serotonin) receptor family, specifically belonging to the 5-HT1 receptor subtype. This receptor is primarily expressed in the central nervous system and plays a crucial role in various physiological processes, including mood regulation, anxiety, and the modulation of neurotransmitter release. Research into HTR1E has gained momentum due to its potential implications in neuropsychiatric disorders such as depression, anxiety disorders, and schizophrenia. The recombinant expression of HTR1E protein allows for detailed investigations into its structure, function, and pharmacological properties. By producing the protein in non-native systems, researchers can study receptor-ligand interactions, signaling pathways, and the receptor's role in downstream effects on neuronal activity. Understanding the molecular mechanisms of HTR1E could lead to the development of novel therapeutic agents targeting this receptor, offering hope for improved treatments for mental health conditions. Additionally, the study of HTR1E might provide insights into the evolutionary aspects of the serotonin receptor family, as variations in its expression and function may contribute to individual differences in behavior and susceptibility to mental health disorders. Overall, the exploration of HTR1E and its recombinant protein forms is vital for uncovering potential therapeutic targets and elucidating the neurobiological underpinnings of mood and anxiety disorders.
