Analytical Data
-
Gene name
Ly6a
- Application
-
Alternative Names
Ly6a；E48；Lymphocyte antigen 6D
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05533
-
Expression Region
27-112aa
-
AA Sequence
LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG
-
Molecular Weight
16.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ly6a, also known as lymphocyte antigen 6 complex, locus A, is a well-studied protein implicated in various biological processes, including hematopoiesis, cell development, and immune response. It is a member of the Ly6 family of proteins, known for their glycosylphosphatidylinositol (GPI) anchor that allows them to associate with the cell membrane. Research into Ly6a has gained traction due to its role as a marker for stem cells and its involvement in the differentiation of several cell types, particularly in the context of immune cell development. The functional mechanisms of Ly6a have been linked to signaling pathways that influence both adaptive and innate immunity, making it a significant target for therapeutic interventions in immunological disorders and cancer. Additionally, its expression patterns during different stages of cell maturation have drawn interest for applications in regenerative medicine and cellular therapies. As a result, the study of Ly6a recombinant proteins has become crucial for elucidating its functional roles and potential applications, paving the way for novel strategies in both basic and translational research.
