Analytical Data
-
Gene name
HDGFRP3
- Application
-
Alternative Names
HDGFL3;HDGF2;HDGFRP3;Hepatoma-derived growth factor-related Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3E1
-
Expression Region
1-203aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSH MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFG THETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQ AIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSY TSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTS EGT
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HDGFRP3 (Hypoxia-Dependent Gene Regulation Protein 3) is a protein that plays a crucial role in cellular responses to hypoxic conditions, which are commonly encountered in various pathological states, including cancer and ischemic diseases. Research has highlighted its involvement in regulating gene expression under low oxygen levels, suggesting that it may influence key cellular processes such as proliferation, survival, and apoptosis. Importantly, the dysregulation of HDGFRP3 has been implicated in tumor progression and metastasis, making it a potential biomarker for cancer diagnosis and prognosis. The recombinant expression of HDGFRP3 allows for in-depth studies of its structure-function relationships and biochemical properties, enabling researchers to dissect its role in cellular pathways and identify potential therapeutic targets. Advances in recombinant protein technology have facilitated the production of HDGFRP3 for high-throughput assays and biochemical characterization, paving the way for novel intervention strategies aimed at mitigating hypoxia-related pathologies. As such, understanding the function and mechanisms of HDGFRP3 could yield significant insights into its potential roles in disease and open avenues for innovative treatments in oncology and beyond.
