Analytical Data
-
Gene name
HSDL1
- Application
-
Alternative Names
Short chain dehydrogenase/reductase family 12C member 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3SXM5
-
Expression Region
2-330aa
-
AA Sequence
AAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA
-
Molecular Weight
64.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSDL1, or hydroxysteroid dehydrogenase-like 1, is an important enzyme that belongs to the aldo-keto reductase family. It plays a significant role in the metabolism of steroid hormones, particularly in the conversion of steroid precursors to active forms. Research on HSDL1 has gained traction due to its potential implications in various physiological processes, including reproductive health, metabolism, and the regulation of inflammation. Understanding HSDL1's structure and function is critical, as dysregulation of its activity has been linked to several diseases, including cancer and metabolic disorders. Recombinant protein studies of HSDL1 aim to elucidate its enzymatic properties, substrate specificity, and regulatory mechanisms. By producing HSDL1 in an engineered system, researchers can systematically investigate its role in steroid metabolism and its clinical relevance. This research could contribute to the development of therapeutic interventions targeting HSDL1-related pathways, particularly in diseases where steroid metabolism is disrupted. Additionally, deciphering the precise biochemical pathways involving HSDL1 may pave the way for novel biomarkers in disease diagnosis and treatment monitoring. Thus, the exploration of HSDL1 and its recombinant protein presents a promising avenue for advancing our understanding of steroid hormone biology and its impact on human health.
