Analytical Data
-
Gene name
PR3
- Application
-
Alternative Names
PR3；C9orf108；C9orf47；EDG3；Sphingosine 1-phosphate receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24158
-
Expression Region
26-249aa
-
AA Sequence
AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRD IPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLS SPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNV TVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCA TRLFPDFFTRVALYVDWIRSTLRRVDHHHHHH
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PR3 (Proteinase 3) is a serine protease primarily expressed in neutrophils, playing a crucial role in the immune response, particularly in the context of inflammation and host defense against pathogens. Research on PR3 has garnered attention due to its involvement in various autoimmune diseases, including Wegener's granulomatosis and other vasculitides, where autoantibodies against PR3 contribute to disease pathology. The study of PR3 as a recombinant protein has opened new avenues for understanding its structure and function, facilitating the development of diagnostic tools and therapeutic strategies. By producing PR3 in recombinant systems, researchers can explore its enzymatic properties, inhibitory mechanisms, and interactions with other biomolecules in a controlled environment. This has significant implications for the design of targeted therapies, antibody production, and elucidating the underlying mechanisms of.autoimmune conditions. Furthermore, the recombinant form of PR3 allows for high-yield purification and characterization, enabling detailed studies on its role within the immune system and its potential as a biomarker. Overall, the investigation of PR3 in its recombinant form represents a pivotal aspect of modern immunological research, bridging basic science and clinical applications.
