Cat: PA1000-1393

Recombinant Human HAO1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HAO1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HAO1;GOX1;2-Hydroxyacid oxidase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UJM8

  • Expression Region

    1-370aa

  • AA Sequence

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMLPRLICINDYEQH AKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLST SVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSS IEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYL GNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVAKAID PSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQ LDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVG RPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLVRKNP LAVSKI

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HAO1, or HAO1 protein, plays a crucial role in cellular metabolism and has garnered significant interest in recent years due to its involvement in various physiological processes. This protein is an enzyme that participates in the oxidative stress response by catalyzing the conversion of hydroxylamines to aldehydes, thus mitigating the potential damage caused by reactive oxygen species (ROS). Research has shown that dysregulation of HAO1 expression is linked to several pathological conditions, including neurodegenerative diseases and cancer. The study of HAO1 recombinant protein is vital for understanding its structure-function relationships, enzymatic mechanisms, and interactions with other cellular components. Moreover, the ability to produce HAO1 in a recombinant form allows for detailed biochemical characterization and the exploration of its therapeutic potential. As researchers continue to elucidate the biological significance of HAO1, the insights gained may pave the way for targeted interventions in diseases associated with oxidative stress and cellular dysfunction. Understanding HAO1's role at a molecular level may also contribute to the development of novel diagnostic and therapeutic approaches aimed at enhancing cellular resilience against oxidative damage. This increasing body of knowledge positions HAO1 at the forefront of metabolic research, underscoring its importance in both basic biology and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US