Analytical Data
-
Gene name
INGAP
- Application
-
Alternative Names
INGAP；Pancreatic beta cell growth factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q06141
-
Expression Region
27-175aa
-
AA Sequence
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
-
Molecular Weight
43.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
INGAP (Insulinoma-Associated Protein) is a crucial peptide that has emerged as a significant subject of research in the context of diabetes and pancreatic function. It was originally identified in insulinoma cells, where it plays a role in the regulation of insulin secretion and cellular proliferation. The interest in INGAP has intensified due to its potential therapeutic implications in regenerative medicine, particularly in the regeneration of pancreatic β-cells, which are critical in maintaining glucose homeostasis. Studies have shown that INGAP can promote the differentiation and survival of these insulin-producing cells, making it a promising candidate for treating type 1 and type 2 diabetes. Moreover, exploring the molecular mechanisms underlying INGAP’s effects can reveal new insights into cellular signaling pathways and regenerative processes. As researchers delve deeper into the structure and function of INGAP, recombinant protein technologies have enabled the production of INGAP for further functional studies, paving the way for potential clinical applications. The ongoing investigation into INGAP’s role in pancreatic health and its regenerative capabilities highlights not only its biological significance but also its potential impact on future diabetes therapies.
