Cat: PA2000-8325

Recombinant Human HOXB7 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HOXB7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HOXB7; HOX2C; Homeobox protein Hox-B7; Homeobox protein HHO.C1; Homeobox protein Hox-2C

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09629

  • Expression Region

    1-217aa

  • AA Sequence

    MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE

  • Molecular Weight

    50.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HOXB7 is a member of the homeobox gene family, which plays a crucial role in development and differentiation processes. It is primarily involved in regulating embryonic development, cellular growth, and tissue patterning. Recent studies have implicated HOXB7 in various cancers, making it a potential biomarker for tumor progression and a target for therapeutic interventions. Specifically, it has been shown to be overexpressed in several malignancies, including breast, lung, and prostate cancers, where it contributes to oncogenic processes, such as increased cell proliferation, migration, and invasion. The recombinant protein of HOXB7 has garnered interest for its potential utility in studies aimed at understanding its functional roles in cancer biology and for developing targeted therapies. By producing a recombinant form of HOXB7, researchers aim to dissect its molecular mechanisms and interactions in cellular signaling pathways. This research could provide valuable insights into its contribution to tumorigenesis and cancer progression, ultimately assisting in the design of novel therapeutic strategies that could hinder HOXB7's oncogenic effects. Understanding the dynamics of HOXB7 expression and function is essential for exploring its dual role as both a crucial developmental regulator and a potential target in cancer treatment. Therefore, the study of HOXB7 and its recombinant protein is critical for advancing our knowledge of cancer biology and improving clinical outcomes in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US