Analytical Data
-
Gene name
GRPEL1
- Application
-
Alternative Names
GRPEL1;GREPEL1;GrpE Protein homolog 1. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HAV7
-
Expression Region
28-217aa
-
AA Sequence
CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
-
Molecular Weight
48.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRPEL1, a member of the Hsp70 chaperone family, plays a crucial role in mitochondrial function and protein homeostasis. Research has shown that GRPEL1 is involved in the assembly of essential mitochondrial components and in the folding of newly synthesized proteins within the mitochondria. Its ability to interact with both mitochondrial chaperones and nascent polypeptides highlights its importance in preventing misfolding and aggregation, which can lead to various mitochondrial diseases. Genetic studies have indicated that mutations in the GRPEL1 gene are associated with a range of pathologies, emphasizing its potential as a biomarker for mitochondrial dysfunction. Given the rising interest in mitochondrial health's impact on aging and metabolic disorders, the study of GRPEL1 recombinant protein provides valuable insights into mitochondrial dynamics and its chaperone mechanisms. Investigating the functionality, interactions, and structural properties of GRPEL1 recombinant protein could facilitate the development of therapeutic strategies targeting mitochondrial diseases and may contribute to the broader understanding of cellular protein maintenance and stress responses. As such, GRPEL1 represents a promising candidate for further research in the field of molecular biology, with the potential to illuminate fundamental processes of cellular health and disease.











