Cat: PA1000-1337

Recombinant Human GRPEL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GRPEL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GRPEL1;GREPEL1;GrpE Protein homolog 1. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HAV7

  • Expression Region

    28-217aa

  • AA Sequence

    CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

  • Molecular Weight

    48.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GRPEL1, a member of the Hsp70 chaperone family, plays a crucial role in mitochondrial function and protein homeostasis. Research has shown that GRPEL1 is involved in the assembly of essential mitochondrial components and in the folding of newly synthesized proteins within the mitochondria. Its ability to interact with both mitochondrial chaperones and nascent polypeptides highlights its importance in preventing misfolding and aggregation, which can lead to various mitochondrial diseases. Genetic studies have indicated that mutations in the GRPEL1 gene are associated with a range of pathologies, emphasizing its potential as a biomarker for mitochondrial dysfunction. Given the rising interest in mitochondrial health's impact on aging and metabolic disorders, the study of GRPEL1 recombinant protein provides valuable insights into mitochondrial dynamics and its chaperone mechanisms. Investigating the functionality, interactions, and structural properties of GRPEL1 recombinant protein could facilitate the development of therapeutic strategies targeting mitochondrial diseases and may contribute to the broader understanding of cellular protein maintenance and stress responses. As such, GRPEL1 represents a promising candidate for further research in the field of molecular biology, with the potential to illuminate fundamental processes of cellular health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US