Analytical Data
-
Gene name
MRTFA
- Application
-
Alternative Names
MRTFA；KIAA1438；MAL；MKL1；Myocardin-related transcription factor A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969V6
-
Expression Region
400-500aa
-
AA Sequence
LHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKE
-
Molecular Weight
25.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRTFA (Myocardin-related transcription factor A) is a member of the MRTF family of transcription regulators that play a crucial role in various cellular processes, including muscle cell differentiation, proliferation, and the regulation of smooth muscle contraction. The study of MRTFA is particularly relevant due to its involvement in pathological conditions such as vascular diseases and cancer. It is known to interact with the actin cytoskeleton, thereby influencing gene expression in response to mechanical and biochemical stimuli. Understanding the structure and function of MRTFA and its signaling pathways can provide insight into the mechanisms underlying cardiovascular diseases and other disorders linked to smooth muscle regulation. The characterization of MRTFA recombinant proteins has become an essential tool in exploring its biological functions and potential as a therapeutic target. Through various biochemical and biophysical techniques, researchers aim to elucidate the molecular mechanisms by which MRTFA modulates transcriptional activity and cellular responses, paving the way for novel interventions in diseases where MRTFA is dysregulated.
