Cat: PA2000-4174

Recombinant Human CRLF3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRLF3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRLF3;CREME9;CRLM9;CYTOR4;Cytokine receptor-like factor 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8IUI8

  • Expression Region

    1-442aa

  • AA Sequence

    MRGAMELEPELLLQEARENVEAAQSYRRELGHRLEGLREARRQIKESASQ TRDVLKQHFNDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIE HGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLV DVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWC KVDDDFTAQDYRLQFRKCTSNHFEDVYVGSETEFIVLHIDPNVDYQFRVC ARGDGRQEWSPWSVPQIGHSTLVPHEWTAGFEGYSLSSRRNIALRNDSES SGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDGYDSLQRDQ AVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAVTLGTTSNNEGGHF KLRVTISSNNREVVFDWLLDQSCGSLYFGCSFFYPGWKVLVF

  • Molecular Weight

    49.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRLF3 (Cytokine Receptor-Like Factor 3) is a relatively novel member of the cytokine receptor family, which plays a crucial role in various biological processes, including immune response and hematopoiesis. Its discovery arose from the need to better understand the regulatory mechanisms of cytokine signaling, as dysregulation in these pathways is often linked to numerous diseases, including cancers and autoimmune disorders. Researchers have identified CRLF3 as being involved in the modulation of signaling pathways that govern cell growth and differentiation. Initial studies suggested that CRLF3 might interact with various cytokines and their receptors, influencing cellular responses to inflammatory stimuli. Furthermore, the potential role of CRLF3 in the development of hematopoietic cells has spurred investigations into its expression patterns in different tissues and during various developmental stages. Notably, the reconstitution of CRLF3 as a recombinant protein has enabled scientists to explore its functional properties in vitro and in vivo models, providing insights into its receptor interactions and downstream signaling effects. This research could unveil novel therapeutic targets for diseases where cytokine signaling is perturbed, highlighting the importance of CRLF3 in both basic and clinical biomedical research. The ongoing studies aim to delineate the precise biological functions of CRLF3 and its implications in health and disease, thereby contributing to a more comprehensive understanding of the cytokine network.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US