Analytical Data
-
Gene name
SNCG
- Application
-
Alternative Names
SNCG；BCSG1；PERSYN；PRSN；Gamma-synuclein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O76070
-
Expression Region
1-127aa
-
AA Sequence
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
-
Molecular Weight
29.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNCG (synuclein gamma), also known as breast cancer-specific gene 1 (BCSG1), is a member of the synuclein family of proteins primarily expressed in the brain and various cancer tissues. Its involvement in neurodegenerative diseases, particularly Parkinson's disease, and its role in cancer cell proliferation and survival has drawn significant attention from researchers. SNCG is thought to function in synaptic transmission and has been linked to cellular mechanisms such as apoptosis and tumorigenesis, making it a focal point in the study of both neurological and oncological disorders. Recent advancements in recombinant protein technology have enabled the production of SNCG in various expression systems, facilitating detailed structure-function studies and providing insights into its molecular mechanisms. Understanding the precise role of SNCG in these pathological conditions could lead to novel therapeutic strategies, targeting either its neuroprotective or oncogenic activities. The exploration of SNCG's interactions with other cellular proteins and its potential as a biomarker for early detection of diseases is also an expanding area of research. Overall, the study of SNCG provides a promising avenue for deciphering the complexities of neurodegenerative and cancerous processes, thereby contributing to the development of innovative diagnostic and treatment modalities.
