Cat: PA2000-4140

Recombinant Human RNF8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RNF8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RNF8;KIAA0646;E3 ubiquitin-Protein ligase RNF8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O76064

  • Expression Region

    1-485aa

  • AA Sequence

    MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQL VSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSI HQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKEL RTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPS DNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFK VTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLC AEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWAL MEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENE LQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYS LVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF

  • Molecular Weight

    79 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RNF8 (Ring Finger Protein 8) is an E3 ubiquitin ligase that plays a crucial role in the DNA damage response and repair mechanisms. It is involved in the recognition and signaling of DNA double-strand breaks (DSBs), a critical form of genomic instability linked to various cancers. RNF8 is essential for the recruitment of DNA repair proteins, such as BRCA1 and 53BP1, to sites of damage, thereby facilitating the repair process. Dysregulation of RNF8 has been associated with impaired DNA repair capacity, leading to increased susceptibility to tumorigenesis. Given its pivotal role in maintaining genomic integrity, RNF8 has gained attention as a potential therapeutic target in cancer treatment. Research into recombinant RNF8 protein aims to understand its structure-function relationships, regulatory mechanisms, and interactions with other repair proteins. This knowledge could pave the way for developing novel strategies to enhance DNA repair pathways in cancer cells, potentially improving the efficacy of existing therapies and advancing personalized medicine approaches. Furthermore, investigating RNF8’s function may reveal insights into the molecular basis of hereditary cancer syndromes linked to defective DNA repair mechanisms. Overall, the study of recombinant RNF8 protein represents a significant avenue for unlocking new insights into the cellular response to DNA damage and the development of cancer therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US