Analytical Data
-
Gene name
GNG4
- Application
-
Alternative Names
GNG4;GNGT4;Guanine nucleotide-binding Protein G(I)/G(S)/G(O) subunit gamma-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50150
-
Expression Region
1-72aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMKEGMSNNSTTSISQARKAVEQLKMEA CMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFC
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNG4, a member of the guanine nucleotide-binding protein subunit family, plays a crucial role in various cellular signaling pathways by regulating the activity of G protein-coupled receptors (GPCRs). The study of GNG4 recombinant protein has gained significance due to its implications in diverse physiological processes, including neurotransmission, immune response, and hormonal regulation. Abnormalities in GNG4 expression or function have been associated with several diseases, including cancer and neurological disorders. Researchers aim to elucidate the biological functions and underlying mechanisms of GNG4 by producing recombinant proteins for detailed structural and functional analysis. This includes examining the interactions with various GPCRs and other signaling molecules, which can provide insights into its role in health and disease. Moreover, obtaining a stable and pure form of GNG4 is essential for developing potential therapeutic strategies targeting related signaling pathways. The ongoing research focuses on optimizing expression systems and purification methods to facilitate detailed studies, aiming to contribute to the understanding of GNG4’s role in cellular signaling and pave the way for novel therapeutic interventions.
