Analytical Data
-
Gene name
HM13
- Application
-
Alternative Names
dJ324O17.1; H13; hIMP1; Histocompatibility (minor) 13; HM13; HM13_HUMAN; IMP-1; IMP1; IMPAS; IMPAS-1; Intramembrane protease 1; Intramembrane protease; Minor histocompatibility antigen 13; Minor histocompatibility antigen H13; MSTP086; OTTHUMP00000030527; OTTHUMP00000030528; OTTHUMP00000030530; OTTHUMP00000214528; Presenilin-like protein 3; PSENL3; PSL3; Signal peptide peptidase; Signal peptide peptidase beta; SPP
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TCT9
-
Expression Region
1-143aa
-
AA Sequence
MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTIRSEGISLQHLKQLSREPVQGLG
-
Molecular Weight
41.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HM13 recombinant protein has garnered significant attention in the field of molecular biology and biochemistry due to its potential applications in therapeutic development and basic research. The HM13 protein, identified from specific microbial sources, exhibits unique structural and functional properties that suggest its involvement in various biological processes, such as immune response modulation and cell signaling. Previous studies have indicated that HM13 may play a role in enhancing the stability and efficacy of therapeutic agents, making it a candidate for drug formulation. Additionally, its ability to interact with specific cellular pathways opens avenues for research into its implications in disease mechanisms, particularly in oncology and infectious diseases. The advent of recombinant DNA technology has facilitated the production and characterization of HM13 in controlled environments, allowing researchers to explore its biological functions, optimize its applications, and assess its potential as a target for novel therapeutics. Understanding the full spectrum of HM13's activities will not only contribute to the advancement of protein engineering but also foster innovations in treatment strategies for various medical conditions. This research holds promise for expanding our knowledge of protein interactions and enhancing therapeutic development.
