Analytical Data
-
Gene name
PDLP7
- Application
-
Alternative Names
PDLP7；CRRSP60；Plasmodesmata-located Protein 7
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q0WPN8
-
Expression Region
31-298aa
-
AA Sequence
TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCSRGGDFSILHSFTLI
-
Molecular Weight
41.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDLP7, or the Plant Defense-related Protein with a Domain of Unknown Function 7, is a member of the PDLP family of proteins that plays a crucial role in plant defense mechanisms. The study of PDLP7 has gained significant attention due to its involvement in plant responses to biotic and abiotic stressors. Emerging research suggests that PDLP7 may be integral in mediating signaling pathways associated with pathogen resistance, particularly in interactions with various pathogens such as bacteria and fungi. Its function is hypothesized to involve the recognition of pathogen-associated molecular patterns (PAMPs) and the activation of downstream defense responses, including the production of reactive oxygen species (ROS) and the expression of defense-related genes. Investigations into the molecular structure and functional properties of PDLP7 are essential for elucidating its precise role in plant immunity. Furthermore, understanding PDLP7's interactions with other proteins and signaling cascades can provide insights into the complex network of plant defense mechanisms. The manipulation of PDLP7 expressions through genetic engineering techniques holds potential for developing crops with enhanced resistance to diseases, thereby contributing to sustainable agriculture. Overall, research on PDLP7 is vital for expanding our knowledge of plant defense systems and for the potential application in improving crop resilience against environmental challenges.
