Analytical Data
-
Gene name
GMPR2
- Application
-
Alternative Names
GMPR2;GMP reductase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P2T1
-
Expression Region
1-348aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPHIDNDVKLDFKDVLLRPKRSTLKSRSEV DLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHY SLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDV ANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGI GPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAK AFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG GVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRR TTFIRVTQQVNPIFSEAC
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GMPR2 (Guanosine Monophosphate Reductase 2) is a crucial enzyme that plays a significant role in purine metabolism, particularly in the catabolism of guanosine monophosphate (GMP) to inosine monophosphate (IMP). This process is vital for maintaining nucleotide balance and energy homeostasis in cells. Research into GMPR2 has gained attention due to its implications in various physiological and pathological processes, including cell proliferation, immune responses, and neurological functions. The enzyme's activity is linked to several health conditions, including neurodegenerative diseases and cancers, making it a potential target for therapeutic intervention. Moreover, GMPR2 has been identified as a promising biomarker in certain diseases, highlighting the need for a deeper understanding of its structure and function. Recent advances in recombinant protein technology have enabled the overexpression and purification of GMPR2, facilitating detailed studies on its enzymatic properties, regulatory mechanisms, and interactions with other cellular components. Investigating the recombinant GMPR2 protein not only provides insights into its catalytic activity but also aids in the development of inhibitors that could be used in drug design. As researchers continue to explore the complexities of GMPR2, the potential for novel therapeutic strategies emerges, underscoring the importance of this enzyme in both basic and translational biomedical research. Overall, GMPR2 represents a compelling subject of study for its multifaceted roles in human health and disease, warranting further investigation into its biochemical pathways and clinical applications.
