Cat: PA2000-68DB

Recombinant Human CK7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CK7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CK7;C11orf13;HRC1;Ras association domain-containing Protein 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08729

  • Expression Region

    1-469aa

  • AA Sequence

    MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVA VRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN KFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRG QLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKD VDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMD NSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA RAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEE SRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPG LLKAYSIRTASASRRSARD

  • Molecular Weight

    78 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CK7 (Cytokeratin 7) is a type of intermediate filament protein that plays a crucial role in the structural integrity of epithelial cells. It is widely studied in the context of various cancers, as its expression patterns can serve as important biomarkers for tumor classification and diagnosis. CK7 is predominantly expressed in specific epithelial tissues, including the lungs, ovaries, and biliary tract, and its presence or absence can help differentiate between primary and metastatic tumors. Recent research has focused on the production and characterization of recombinant CK7 proteins, which are vital for elucidating the protein's functional properties and its role in cellular processes. Recombinant CK7 can be utilized in various applications, such as immunohistochemistry, where it aids in the identification of specific tumor types, and in studying the molecular mechanisms of cancer progression. Moreover, the development of recombinant CK7 provides a platform for therapeutic advancements, including the potential use of CK7-targeted therapies. As researchers continue to explore CK7's implications in cancer biology, understanding its expression and regulation may lead to improved diagnostic and therapeutic strategies, ultimately contributing to better patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US