Analytical Data
-
Gene name
PMT5
- Application
-
Alternative Names
PMT5；Dolichyl-phosphate-mannose--Protein mannosyltransferase 5
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52867
-
Expression Region
286-583aa
-
AA Sequence
SVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSAVSLNHVGTAGGYLHSHLHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHPNENVTSFQNLTDGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAIETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAYFAREDLTSWYIEENENEISLPNPEKVSYKKMSFWQKFVAIHKFMFYLNNYMDTSHAYSSEPKTWPLMLRGIDFWNENGREVYFLGNA
-
Molecular Weight
38.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PMT5 (Phytotoxin Modulation Target 5) protein has garnered significant attention in recent years due to its pivotal role in plant-pathogen interactions and resistance mechanisms. This research background stems from the escalating challenges posed by plant diseases, which threaten agricultural productivity and food security worldwide. Understanding the molecular basis of how PMT5 functions can provide valuable insights into the defense responses of plants against various pathogens, including fungi and bacteria. Studies have suggested that PMT5 may act as a key player in modulating phytohormone signaling pathways, thus influencing plant immune responses. Furthermore, the exploration of PMT5's structure and function can facilitate the development of biotechnological applications aimed at enhancing crop resistance to disease through genetic engineering or breeding programs. As such, unraveling PMT5’s mechanisms of action not only contributes to our fundamental understanding of plant biology but also has practical implications for sustainable agriculture in the face of climate change and increasing pest pressures. The ongoing research initiatives are focused on elucidating the biochemical interactions of PMT5 and its downstream effects, paving the way for innovative strategies to bolster plant health and resist disease effectively.
