Analytical Data
-
Gene name
HIST2H3C
- Application
-
Alternative Names
HIST2H3A;; HIST2H3C; H3F2; H3FM;; HIST2H3D; Histone H3.2; Histone H3/m; Histone H3/o
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q71DI3
-
Expression Region
1-136aa
-
AA Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
-
Molecular Weight
41.91 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST2H3C, a gene coding for the histone H3.3 protein, plays a crucial role in the regulation of gene expression and chromatin structure. Histone proteins are vital components of eukaryotic chromatin, serving as spools around which DNA winds to form nucleosomes, the fundamental units of chromatin. The H3 variant, specifically H3.3, is associated with active transcription and is found in regions of the genome undergoing dynamic changes, which implicates it in key cellular processes including differentiation, development, and response to environmental stimuli. Research into the recombinant production of HIST2H3C has gained traction due to its potential applications in understanding epigenetic regulation and its implications in diseases such as cancer, where aberrations in chromatin remodeling and histone modifications are prevalent. The generation of recombinant HIST2H3C proteins allows for the detailed study of their biochemical properties, interactions with DNA, and their role in histone modification processes. Understanding the functional dynamics of HIST2H3C through recombinant technologies can provide insights into the mechanisms of transcriptional regulation and pave the way for novel therapeutic strategies targeting epigenetic alterations in various pathologies.
