Analytical Data
-
Gene name
MTOR
- Application
-
Alternative Names
MTOR；FRAP；FRAP1；FRAP2；Serine/threonine-Protein kinase mTOR
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42345
-
Expression Region
1521-1620aa
-
AA Sequence
WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDL LDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The mechanistic target of rapamycin (mTOR) is a crucial serine/threonine kinase that functions as a central regulator of cell growth, proliferation, and survival, integrating signals from nutrients, growth factors, and cellular energy status. Its dysregulation is implicated in various diseases, including cancer, metabolic disorders, and neurodegenerative diseases. Research on recombinant mTOR proteins has gained significant attention due to their potential applications in understanding the signaling pathways involved in these conditions and developing novel therapeutic strategies. By producing and characterizing recombinant mTOR proteins, scientists can investigate its structural properties, enzymatic activity, and interactions with various substrates and inhibitors, thereby elucidating the mechanisms by which mTOR affects cellular functions. Furthermore, these studies can contribute to the identification of mTOR-related biomarkers and aid in the design of mTOR inhibitors, which have shown promise in clinical trials as targeted therapies. Thus, investigating recombinant mTOR proteins serves not only to enhance the basic understanding of mTOR biology but also to advance the development of effective treatments for diseases associated with its dysfunction.
