Analytical Data
-
Gene name
HIST2H2AA
- Application
-
Alternative Names
H2a 615; H2A; H2A GL101; H2A histone family member A; H2A.1; H2A.2; H2A/a; H2A/m; H2A/O; H2A/q; H2A1B_HUMAN; H2AFA; H2AFE; H2AFL; H2AFM; H2AFO; H2AFQ; HIST1H2AE; HIST1H2AJ; HIST2H2AA; HIST2H2AA3; HIST2H2AB; HIST2H2AC; Histone 1 H2ae; Histone 2 H2aa3; Histone 2 H2ab; Histone 2 H2ac; Histone H2A type 1 B; Histone H2A type 1 C; Histone H2A type 1 E; Histone H2A type 1 J; Histone H2A type 1-B/E; Histone H2A.2; Histone H2A/a; Histone H2A/m; MGC74460
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04908
-
Expression Region
1-130aa
-
AA Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
-
Molecular Weight
40.04 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST2H2AA is a member of the histone H2A family, specifically involved in the regulation of chromatin structure and gene expression. Histones, including HIST2H2AA, play a crucial role in DNA packaging within the nucleus, allowing for the efficient organization and accessibility of genetic material. Research on HIST2H2AA has gained importance due to its potential implications in various biological processes, such as cell cycle regulation, DNA repair, and epigenetic modifications. The aberrant expression of histone proteins has been linked to several diseases, including cancer, making the study of HIST2H2AA particularly relevant in understanding tumorigenesis and identifying new therapeutic targets. Moreover, advancements in recombinant protein technology have enabled researchers to produce and analyze HIST2H2AA more effectively, providing insights into its structural and functional properties. Investigating the role of HIST2H2AA in chromatin dynamics and its interactions with other nuclear proteins is essential for uncovering its specific contributions to cellular function and stability, paving the way for potential applications in gene therapy and regenerative medicine. By exploring the biophysical characteristics and biological roles of HIST2H2AA, scientists aim to develop targeted strategies that can modulate its activity for therapeutic purposes.
