Cat: PA2000-4113

Recombinant Mouse Stfa2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Stfa2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Stfa2;Stf-2;Stf2;Stefin-2

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35174

  • Expression Region

    1-103aa

  • AA Sequence

    MTEYTRKIKGGLSEARPATSEIQEIADKVRPLLEEKTNEKYEKFKAIEYKVQVVQGLNYFIKMNVGRGCYLHINVLSGISSENDLELTGYQTNKAKNDELTYF

  • Molecular Weight

    17.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Stfa2 is a recombinant protein that has garnered significant attention in the field of biotechnology and molecular biology due to its potential applications in various biotherapeutic processes. Initially identified as a part of the antifungal defense system in certain organisms, Stfa2 has shown promise in its ability to inhibit the growth of pathogenic fungi, making it a key candidate for developing novel antifungal agents. Researchers have focused on elucidating its structure and function, aiming to understand the molecular mechanisms underlying its antifungal activity. The recombinant expression of Stfa2 in suitable host systems allows for functional studies and the exploration of its interactions with fungal cells. This research is crucial as fungal infections pose a serious health threat, particularly for immunocompromised individuals. By harnessing the properties of Stfa2, scientists hope to contribute to the development of more effective treatments for fungal infections, addressing a pressing need in the field of medicine. Additionally, understanding the pathways by which Stfa2 exerts its effects can pave the way for innovative strategies in pathogen control and provide insights into protein engineering for therapeutic uses. The ongoing investigation into Stfa2 is not only expanding our knowledge of antifungal proteins but is also offering avenues for biotechnological advancements in the treatment of fungal diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US