Analytical Data
-
Gene name
HIST1H4K
- Application
-
Alternative Names
dJ160A22.1; dJ160A22.2; dJ221C16.1; dJ221C16.9; FO108; H4; H4.k; H4/a; H4/b; H4/c; H4/d; H4/e; H4/g; H4/h; H4/I; H4/j; H4/k; H4/m; H4/n; H4/p; H4_HUMAN; H4F2; H4F2iii; H4F2iv; H4FA; H4FB; H4FC; H4FD; H4FE; H4FG; H4FH; H4FI; H4FJ; H4FK; H4FM; H4FN; H4M; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4; HIST2H4A; Hist4h4; Histone 1 H4a; Histone 1 H4b; Histone 1 H4c; Histone 1 H4d; Histone 1 H4e; Histone 1 H4f
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62805
-
Expression Region
1-103aa
-
AA Sequence
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
-
Molecular Weight
38.28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H4K, a gene encoding histone H4, is a crucial component of the structural and functional framework of chromatin in eukaryotic cells. Histones are proteins that package and order DNA into nucleosomes, playing a significant role in gene regulation, DNA replication, and repair. The modification of histones through acetylation, methylation, and other post-translational modifications can influence chromatin structure and, subsequently, gene expression patterns. Given the implications of histone modifications in various biological processes and diseases, including cancer, there has been increasing interest in the study of HIST1H4K and its recombinant protein. Researchers aim to investigate its role in histone acetylation and methylation pathways, understanding how these modifications affect chromatin dynamics and gene expression. By generating recombinant HIST1H4K proteins, scientists can explore the functional consequences of specific modifications on chromatin interactions, transcriptional regulation, and cellular responses to environmental stimuli. Furthermore, studying HIST1H4K can provide insights into epigenetic mechanisms and their potential therapeutic targets in disorders where histone dysregulation is implicated. Overall, the research on HIST1H4K recombinant protein offers valuable opportunities to dissect the intricate relationships between histone modifications, chromatin structure, and gene expression, contributing to the broader understanding of cellular biology and disease mechanisms.
