Cat: PA2000-4112

Recombinant Human Stfa1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Stfa1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Stfa1;Stf-1;Stf1;Stefin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35175

  • Expression Region

    1-97aa

  • AA Sequence

    MSLGGVSEASRATPEIQMIANKVRPQLEAKTNKKYEKFEAVEYKTQVVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTMDEELTYF

  • Molecular Weight

    16.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Stfa1, or Staphylococcus aureus factor 1, is a protein derived from the pathogenic bacterium Staphylococcus aureus, which is known for its role in various human infections, including skin and soft tissue infections, pneumonia, and bloodstream infections. The study of Stfa1 is significant due to the increasing prevalence of antibiotic-resistant strains of Staphylococcus aureus, particularly Methicillin-resistant Staphylococcus aureus (MRSA). Understanding the structure and function of Stfa1 can provide insights into the molecular mechanisms of bacterial virulence and host-pathogen interactions. Researchers focus on characterizing this recombinant protein to explore its potential as a target for novel therapeutic interventions and vaccine development. By producing Stfa1 in a recombinant form, scientists aim to elucidate its role in immune evasion and to assess its immunogenic properties. This knowledge is crucial for designing effective strategies to combat infections caused by this versatile and resilient pathogen. Furthermore, the study of Stfa1 contributes to our broader understanding of the biology of Staphylococcus aureus and its interactions with the host immune system, potentially leading to innovative approaches to prevent and treat severe infections.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US