Analytical Data
-
Gene name
Stfa1
- Application
-
Alternative Names
Stfa1;Stf-1;Stf1;Stefin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35175
-
Expression Region
1-97aa
-
AA Sequence
MSLGGVSEASRATPEIQMIANKVRPQLEAKTNKKYEKFEAVEYKTQVVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTMDEELTYF
-
Molecular Weight
16.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Stfa1, or Staphylococcus aureus factor 1, is a protein derived from the pathogenic bacterium Staphylococcus aureus, which is known for its role in various human infections, including skin and soft tissue infections, pneumonia, and bloodstream infections. The study of Stfa1 is significant due to the increasing prevalence of antibiotic-resistant strains of Staphylococcus aureus, particularly Methicillin-resistant Staphylococcus aureus (MRSA). Understanding the structure and function of Stfa1 can provide insights into the molecular mechanisms of bacterial virulence and host-pathogen interactions. Researchers focus on characterizing this recombinant protein to explore its potential as a target for novel therapeutic interventions and vaccine development. By producing Stfa1 in a recombinant form, scientists aim to elucidate its role in immune evasion and to assess its immunogenic properties. This knowledge is crucial for designing effective strategies to combat infections caused by this versatile and resilient pathogen. Furthermore, the study of Stfa1 contributes to our broader understanding of the biology of Staphylococcus aureus and its interactions with the host immune system, potentially leading to innovative approaches to prevent and treat severe infections.











